PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.005G026300.1
Common NamePHAVU_005G026300g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family SRS
Protein Properties Length: 344aa    MW: 37157.5 Da    PI: 7.8693
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.005G026300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF7021846e-571442947153
              DUF702   7 sCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa.....aeaaskrkrelkskkqsalsstkls 92 
                          CqdCGn+akkdC ++RCRtCCk rg+dC+thvkstW+p+ +rrer    a+a+   +++      + +++    +++s++++++ ++  +
  Phvul.005G026300.1 144 VCQDCGNRAKKDCIFRRCRTCCKGRGYDCNTHVKSTWIPSIRRRERDMVVASAAGGGSKRPraivgS-SQNATATSHSSNSNATTPKSLAT 233
                         6*********************************************887777655444433344431.22222222222222222222222 PP

              DUF702  93 saeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGle 153
                          ++++    ++slP +v+++avf+c rvs++ +ge+e+aY ++v+i+GhvfkG+Lyd+G++
  Phvul.005G026300.1 234 ISSHQDGRLKESLPGHVRAPAVFKCHRVSAIGNGEDEFAYLATVQISGHVFKGFLYDHGVD 294
                         222333455566***********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051423.0E-54144294IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016238.6E-26144186IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016246.3E-24246293IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MSMLGLRDLV LIAQTPSLHQ HHHHHHHQHQ GQQQPISENQ TPNLPLPSSA ALSVGFGIFP  60
LLTATPCVPH PHQTNEIQEC GGGGGGAATT TNYWNLKMCP EVNPPKKGVM NMDDDEDEDD  120
ERHHQHKGVM ESEENGIYGP DFRVCQDCGN RAKKDCIFRR CRTCCKGRGY DCNTHVKSTW  180
IPSIRRRERD MVVASAAGGG SKRPRAIVGS SQNATATSHS SNSNATTPKS LATISSHQDG  240
RLKESLPGHV RAPAVFKCHR VSAIGNGEDE FAYLATVQIS GHVFKGFLYD HGVDGKIGNA  300
VPCVSELQLG NNCSGKNREC SSAIGLPNNT AYPASATSTF LNR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150400.0AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007148931.10.0hypothetical protein PHAVU_005G026300g
SwissprotQ94CK97e-55LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBLV7BV460.0V7BV46_PHAVU; Uncharacterized protein
STRINGGLYMA04G17885.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF57043154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.23e-51Lateral root primordium (LRP) protein-related